Fill-Mask
Transformers
Safetensors
esm

FusOn-pLM: A Fusion Oncoprotein-Specific Language Model via Focused Probabilistic Masking

image/png In this work, we introduce FusOn-pLM, a novel pLM that fine-tunes the state-of-the-art ESM-2-650M protein language model (pLM) on fusion oncoprotein sequences, those that drive a large portion of pediatric cancers but are heavily disordered and undruggable. We specifically introduce a novel cosine-scheduled masked language modeling (MLM) strategy which varies the number of masked residues throughout each epoch, thereby increasing the difficulty of the training task and generating more optimal fusion oncoprotein-aware embeddings. Our model improves performance on both fusion oncoprotein-specific benchmarks and disorder prediction tasks in comparison to baseline ESM-2 representations, as well as manually-constructed biophysical embeddings, motivating downstream usage of FusOn-pLM embeddings for therapeutic design tasks targeting these fusions. Please feel free to try out our embeddings and reach out if you have any questions!

How to generate FusOn-pLM embeddings for your fusion oncoprotein:

from transformers import AutoTokenizer, AutoModel
import logging
import torch

# Suppress warnings about newly initialized 'esm.pooler.dense.bias', 'esm.pooler.dense.weight' layers - these are not used to extract embeddings
logging.getLogger("transformers.modeling_utils").setLevel(logging.ERROR)

# Set device
device = torch.device("cuda" if torch.cuda.is_available() else "cpu")
print(f"Using device: {device}")

# Load the tokenizer and model
model_name = "ChatterjeeLab/FusOn-pLM" 
tokenizer = AutoTokenizer.from_pretrained(model_name)
model = AutoModel.from_pretrained(model_name)
model.to(device)
model.eval()

# Example fusion oncoprotein sequence: MLLT10:PICALM, associated with Acute Myeloid Leukemia (LAML)  
# Amino acids 1-80 are derived from the head gene, MLLT10
# Amino acids 81-119 are derived from the tail gene, PICALM
sequence = "MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM"

# Tokenize the input sequence
inputs = tokenizer(sequence, return_tensors="pt", padding=True, truncation=True,max_length=2000)
inputs = {k: v.to(device) for k, v in inputs.items()}

# Get the embeddings
with torch.no_grad():
    outputs = model(**inputs)
    # The embeddings are in the last_hidden_state tensor
    embeddings = outputs.last_hidden_state
    # remove extra dimension
    embeddings = embeddings.squeeze(0)
    # remove BOS and EOS tokens
    embeddings = embeddings[1:-1, :]

# Convert embeddings to numpy array (if needed)
embeddings = embeddings.cpu().numpy()

print("Per-residue embeddings shape:", embeddings.shape)

Repository Authors

Sophia Vincoff, PhD Student at Duke University
Pranam Chatterjee, Assistant Professor at Duke University

Reach out to us with any questions!

Downloads last month
88
Safetensors
Model size
0.7B params
Tensor type
F32
ยท
Inference Providers NEW
This model isn't deployed by any Inference Provider. ๐Ÿ™‹ Ask for provider support

Space using ChatterjeeLab/FusOn-pLM 1